Web Analysis for Onlinemarketingreviewsandtips - onlinemarketingreviewsandtips.com
onlinemarketingreviewsandtips.com is 1 decade 2 years old. It is a domain having com extension. It has a global traffic rank of #1528854 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, onlinemarketingreviewsandtips.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Not Applicable
Traffic Report
| Daily Unique Visitors: | 315 |
| Daily Pageviews: | 630 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | 227 |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | 1,528,854 |
| Domain Authority: | 9 ON 100 |
Web Server Information
Hosted IP Address:
96.125.161.206
Hosted Country:
US
Location Latitude:
29.7633Location Longitude:
-95.3633Websites Hosted on Same IP (i.e. 96.125.161.206)
Artikel-Schrijven.com
Artikel Schrijven Is Een Verzamelplaats Van Kwaliteits Artikelen. Artikel Schrijven Geeft Je Relevante Backlinks Voor Je Artikel En Een Hogere Ranking !
93,532
$
88,560.00
Domain Information
| Domain Registrar: |
Nimzo 77, LLC
|
|---|---|
| Registration Date: | Jun 5, 2011, 12:00 AM 1 decade 2 years 10 months ago |
| Last Modified: | Jun 5, 2012, 12:00 AM 1 decade 1 year 10 months ago |
| Expiration Date: | Jun 4, 2013, 12:00 AM 1 decade 10 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns827.hostgator.com |
|
192.185.224.58 |
United States of America
|
| ns828.hostgator.com |
|
192.185.224.59 |
United States of America
|
Similarly Ranked Websites
Home - Dark Knight News
The Dark Knight news is a fan based site dedicated to the iconic DC hero, Batman. Get the latest Batman news, Batman comic news & Dark Knight movie news!
1,528,855
$
720.00
Darshana Industries Pvt. Ltd. Pune
Darshana Industries Pvt. Ltd.
1,528,856
$
720.00
Anonymous Bullying Reporting App for Schools and Districts - BRIM
BRIM pairs a cloud-based anonymous bullying reporting page and Admin Panel with mobile reporting apps for students, parents and teachers.
1,528,858
$
720.00
